Please use this identifier to cite or link to this item:
https://dspace.iiti.ac.in/handle/123456789/10782
Full metadata record
| DC Field | Value | Language |
|---|---|---|
| dc.contributor.author | Jakhmola, Shweta | en_US |
| dc.contributor.author | Sk, Md Fulbabu | en_US |
| dc.contributor.author | Chatterjee, AkashJain, Khushboo | en_US |
| dc.contributor.author | Kar, Parimal | en_US |
| dc.contributor.author | Jha, Hem Chandra | en_US |
| dc.date.accessioned | 2022-11-03T19:39:11Z | - |
| dc.date.available | 2022-11-03T19:39:11Z | - |
| dc.date.issued | 2022 | - |
| dc.identifier.citation | Jakhmola, S., Sk, M. F., Chatterjee, A., Jain, K., Kar, P., & Jha, H. C. (2022). A plausible contributor to multiple sclerosis; presentation of antigenic myelin protein epitopes by major histocompatibility complexes. Computers in Biology and Medicine, 148 doi:10.1016/j.compbiomed.2022.105856 | en_US |
| dc.identifier.issn | 0010-4825 | - |
| dc.identifier.other | EID(2-s2.0-85134231568) | - |
| dc.identifier.uri | https://doi.org/10.1016/j.compbiomed.2022.105856 | - |
| dc.identifier.uri | https://dspace.iiti.ac.in/handle/123456789/10782 | - |
| dc.description.abstract | Background: Multiple sclerosis (MS) can be induced upon successful presentation of myelin antigens by MHC I/II. Antigenic similarity between the myelin and viral proteins may worsen the immunological responses. Methodology: Antigenic regions within myelin proteins; PLP1, MBP, MOG, and MAG were analyzed using SVMTrip and EMBOSS. Homology search identified sequence similarity between the predicted host epitopes and viral proteins. NetMHCpan predicted MHC I/II binding followed by peptide-protein docking through the HPEPDOCK server. Thereafter we analyzed conformational flexibility and stability of 15 protein-peptide complexes based on high docking scores. The binding free energy was calculated using conventional (MD) and Gaussian accelerated molecular dynamics simulation. Results: PLP1, MBP, MAG and MOG contained numerous antigenic epitopes. MBP and MOG epitopes had sequence similarity to HHV-6 BALF5; EBNA1 and CMV glycoprotein M (gM), and EBV LMP2B, gp350/220; HHV-8 ORFs respectively. Many herpes virus proteins like tegument, envelope glycoproteins, and ORFs of EBV, CMV, HHV-6, and HHV-8 demonstrated sequence similarity with MAG and PLP1. Some antigenic peptides were also linear B-cell epitopes and influenced cytokine production by T-cell. MHC I allele HLA-B*57:01 bound to PLP1 peptide and HLA-A*68:02 bound to a MAG peptide strongly. MHC II alleles HLA-DRB1*04:05 and HLA-DR1*01:01 associated with MAG- and MOG-derived peptides, respectively, demonstrating high HPEPDOCK scores. MD simulations established stable binding of certain peptides with the MHC namely HLA-B*51:01-MBP(DYKSAHKGFKGVDAQGTLSKIFKL), HLA-B*57:01-PLP1(PDKFVGITYALTVVWLLVFACSAVPVYIYF), HLA-DR1*01:01-MOG(VEDPFYWVSPGVLVLLAVLPVLLLQITVGLVFLCLQYR) and HLA-DRB1*04:05-MAG(TWVQVSLLHFVPTREA). Conclusions: Cross-reactivity between self-antigens and pathogen derived immunodominant epitopes may induce MS. Our study supported the role of specific MHC alleles as a contributing MS risk factor. © 2022 Elsevier Ltd | en_US |
| dc.language.iso | en | en_US |
| dc.publisher | Elsevier Ltd | en_US |
| dc.source | Computers in Biology and Medicine | en_US |
| dc.subject | Binding energy; Epitopes; Free energy; Genes; Glycoproteins; Molecular dynamics; Peptides; T-cells; Antigenics; GaMD simulation; Herpes virus; Major histocompatibility complex; Molecular docking; Molecular mimicry; Multiple sclerosis; Myelin protein; Sequence similarity; Viral proteins; Viruses; epitope; HLA DR1 antigen; HLA DRB1 antigen; myelin oligodendrocyte glycoprotein; peptide; viral protein; cytomegalovirus infection; histocompatibility; human; multiple sclerosis; Cytomegalovirus Infections; Epitopes, B-Lymphocyte; Histocompatibility; HLA-DR1 Antigen; HLA-DRB1 Chains; Humans; Multiple Sclerosis; Myelin-Oligodendrocyte Glycoprotein; Peptides; Viral Proteins | en_US |
| dc.title | A plausible contributor to multiple sclerosis; presentation of antigenic myelin protein epitopes by major histocompatibility complexes | en_US |
| dc.type | Journal Article | en_US |
| Appears in Collections: | Mehta Family School of Biosciences and Biomedical Engineering | |
Files in This Item:
There are no files associated with this item.
Items in DSpace are protected by copyright, with all rights reserved, unless otherwise indicated.
Altmetric Badge: